SAB5702444

Anti-Rad50 Antibody, clone 5M2K10, Rabbit Monoclonal

• Sinónimos: NBSLD, RAD502, hRad50
• Código UNSPSC: 12352203
• NACRES: NA.46
• clon: 5M2K10, monoclonal
• application: IP; WB
• reactividad de especies: rat, human, rat
• técnicas: immunoprecipitation (IP): 1:50 - 1:200; western blot: 1:500 - 1:2000

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• Materiales: colorless
• clon: 5M2K10, monoclonal
• Formulario: liquid
• mol peso: 154 kDa
• reactividad de especies: rat, human, rat
• concentración: 0.85 mg/mL
• técnicas: immunoprecipitation (IP): 1:50 - 1:200; western blot: 1:500 - 1:2000
• color: colorless
• isotipo: IgG
• secuencia del inmunógeno: RCSAGQKVLASLIIRLALAETFCLNCGIIALDEPTTNLDRENIESLAHALVEIIKSRSQQRNFQLLVITHDEDFVELLGRSEYVEKFYRIKKNIDQCSEIV
• Nº de acceso UniProt: Q92878
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... RAD50(10111)

Descripción

Descripción general

The protein encoded by this gene is highly similar to Saccharomyces cerevisiae Rad50, a protein involved in DNA double-strand break repair. This protein forms a complex with MRE11 and NBS1. The protein complex binds to DNA and displays numerous enzymatic activities that are required for nonhomologous joining of DNA ends. This protein, cooperating with its partners, is important for DNA double-strand break repair, cell cycle checkpoint activation, telomere maintenance, and meiotic recombination. Knockout studies of the mouse homolog suggest this gene is essential for cell growth and viability. Mutations in this gene are the cause of Nijmegen breakage syndrome-like disorder.[provided by RefSeq, Apr 2010]

Inmunógeno

A synthetic peptide corresponding to a sequence within amino acids 1200-1300 of human Rad50 (Q92878).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Aplicación

WB,IP

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1