SAB5702254

Anti-Somatostatin (SST) Antibody, clone 7Q4T0, Rabbit Monoclonal

• Sinónimos: SST,SMST
• Código UNSPSC: 12352203
• NACRES: NA.46

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• Materiales: colorless
• clon: 7Q4T0, monoclonal
• formulario: liquid
• reactividad de especies: mouse, rat
• concentración: 1 mg/mL
• técnicas: immunohistochemistry: 1:50 - 1:200
• color: colorless
• isotipo: IgG
• secuencia del inmunógeno: TGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEPNQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC
• Nº de acceso UniProt: P61278
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... SST(6750)

Descripción

Descripción general

The hormone somatostatin has active 14 aa and 28 aa forms that are produced by alternate cleavage of the single preproprotein encoded by this gene. Somatostatin is expressed throughout the body and inhibits the release of numerous secondary hormones by binding to high-affinity G-protein-coupled somatostatin receptors. This hormone is an important regulator of the endocrine system through its interactions with pituitary growth hormone, thyroid stimulating hormone, and most hormones of the gastrointestinal tract. Somatostatin also affects rates of neurotransmission in the central nervous system and proliferation of both normal and tumorigenic cells.

Inmunógeno

PBS with 0.05% proclin300,0.05% BSA,50% glycerol,pH7.3.

Recombinant fusion protein containing a sequence corresponding to amino acids 23-116 of human Somatostatin (SST) (NP_001039.1).

Aplicación

IHC

Información de seguridad

• Pictogramas: GHS07,GHS09
• Palabra de señalización: Warning
• Frases de peligro: H317,H411
• Consejos de prudencia: P261 - P272 - P273 - P280 - P302 + P352 - P333 + P313
• Clasificaciones de peligro: Aquatic Chronic 2 - Skin Sens. 1
• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3