SAB5702087

Anti-Kinesin light chain 1 (KLC1) Antibody, clone 5C3P5, Rabbit Monoclonal

• Sinónimos: KLC1, KLC, KNS2, KNS2A, kinesin light chain 1
• Código UNSPSC: 12352203
• NACRES: NA.41
• clon: 5C3P5, monoclonal
• application: WB
• reactividad de especies: human, rat, rat
• técnicas: western blot: 1:500 - 1:2000

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• Materiales: colorless
• clon: 5C3P5, monoclonal
• Formulario: liquid
• reactividad de especies: human, rat, rat
• concentración: 0.67 mg/mL
• técnicas: western blot: 1:500 - 1:2000
• color: colorless
• isotipo: IgG
• secuencia del inmunógeno: GGWYKACKVDSPTVTTTLKNLGALYRRQGKFEAAETLEEAAMRSRKQGLDNVHKQRVAEVLNDPENMEKRRSRESLNVDVVKYESGPDGGEEVSMSVEWNG
• Nº de acceso UniProt: Q07866
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... KLC1(3831)

Descripción

Descripción general

Conventional kinesin is a tetrameric molecule composed of two heavy chains and two light chains, and transports various cargos along microtubules toward their plus ends. The heavy chains provide the motor activity, while the light chains bind to various cargos. This gene encodes a member of the kinesin light chain family. It associates with kinesin heavy chain through an N-terminal domain, and six tetratricopeptide repeat (TPR) motifs are thought to be involved in binding of cargos such as vesicles, mitochondria, and the Golgi complex. Thus, kinesin light chains function as adapter molecules and not motors per se. Although previously named ′kinesin 2′, this gene is not a member of the kinesin-2 / kinesin heavy chain subfamily of kinesin motor proteins. Extensive alternative splicing produces isoforms with different C-termini that are proposed to bind to different cargos; however, the full-length nature and/or biological validity of most of these variants have not been determined.

Inmunógeno

A synthetic peptide corresponding to a sequence within amino acids 450-550 of human Kinesin light chain 1 (KLC1) (Q07866).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Aplicación

WB

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1