SAB5201356

Monoclonal Anti-Ataxin 1 antibody produced in mouse

clone S76-8, purified immunoglobulin

• Sinónimos: Anti-ATX1, Anti-D6S504E, Anti-Spinocerebellar ataxia type 1 protein
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: mouse
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: S76-8, monoclonal
• formulario: buffered aqueous solution
• mol peso: antigen predicted mol wt 85 kDa
• reactividad de especies: human, mouse, rat
• concentración: 1 mg/mL
• técnicas: immunohistochemistry: suitable; immunoprecipitation (IP): suitable; western blot: suitable
• isotipo: IgG2b
• Nº de acceso NCBI: NP_001186233.1
• Nº de acceso UniProt: P54253
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: mouse ... Atxn1(20238)

Descripción

Inmunógeno

Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).

Características y beneficios

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Forma física

PBS pH 7.4, 50% glycerol, 0.1% sodium azide

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable