SAB2108772

Anti-PAX2 antibody produced in rabbit biotin conjugated

affinity isolated antibody

• Sinónimos: CPT1-M, CPT1M, CPTI, KIAA1670, M-CPT1
• Código UNSPSC: 12352203

Propiedades

• origen biológico: rabbit
• conjugado: biotin conjugate
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• formulario: buffered aqueous solution
• mol peso: 42 kDa
• reactividad de especies (predicha por homología): guinea pig, rat, horse, canine, mouse, rabbit, bovine, zebrafish, human
• concentración: 0.5 mg/mL
• Nº de acceso NCBI: NM_000278
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... PAX2(5076)

Descripción

Descripción general

PAX2 encodes paired box gene 2, one of many human homologues of the Drosophila melanogaster gene prd. The central feature of this transcription factor gene family is the conserved DNA-binding paired box domain. PAX2 is believed to be a target of transcriptional supression by the tumor supressor gene WT1. Mutations within PAX2 have been shown to result in optic nerve colobomas and renal hypoplasia.

Inmunógeno

Synthetic peptide directed towards the middle region of Human PAX2

Secuencia

Synthetic peptide located within the following region: DPVGSYSINGILGIPRSNGEKRKRDEDVSEGSVPNGDSQSGVDSLRKHLR

Forma física

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): nwg
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable