Saltar al contenido
Merck
Todas las fotos(3)

Key Documents

SAB2108744

Sigma-Aldrich

Anti-ZEB2

affinity isolated antibody

Sinónimos:

Anti- SIP-1, Anti- SIP1, Anti- SMADIP1, Anti- ZFHX1B, Anti-KIAA0569

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
Todas las fotos(3)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

100

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

formulario

buffered aqueous solution

mol peso

136 kDa

reactividad de especies

human, horse, mouse, bovine, pig, rat

concentración

0.5-1 mg/mL

técnicas

immunoblotting: suitable
immunohistochemistry: suitable

nº de acceso

NM_014795

Nº de acceso UniProt

O60315

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... ZEB2(9839)

Inmunógeno

Synthetic peptide directed towards the middle region of human ZEB2

Acciones bioquímicas o fisiológicas

The ZFHX1B gene is a member of the delta-EF1/Zfh1 family of 2-handed zinc finger/homeodomain proteins. ZFHX1B is strongly transcribed at an early stage in the developing peripheral and central nervous systems of both mice and humans, in all neuronal regions of the brains of 25-week human fetuses and adult mice, and in numerous nonneural tissues. The SMADIP1 gene (also known as SIP1) is a member of the delta-EF1 (ZEB1; MIM 189909)/Zfh1 family of 2-handed zinc finger/homeodomain proteins. SMADIP1 interacts with receptor-mediated, activated full-length SMADs (see MIM 605568) (Verschueren et al., 1999 [PubMed 10400677]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-58 AB056507.1 1-58 59-553 AL118674.1 57-551 554-5558 AB056507.1 553-5557 5559-5583 AI858477.1 1-25 c

Secuencia

Synthetic peptide located within the following region: LGRQDGDEEFEEEEEESENKSMDTDPETIRDEEETGDHSMDDSSEDGKME

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Yuh-Shyan Tsai et al.
Urologic oncology, 37(11), 810-810 (2019-06-30)
Indoleamine-2,3-dioxygenase-1 (IDO1) is a key enzyme of tryptophan metabolism which regulates T cell function in immune cells and little is known about the role of IDO1 expression in bladder cancer cells. The study is aimed to evaluate the clinical relevance
Mary Patrice Eastwood et al.
Prenatal diagnosis, 38(9), 645-653 (2018-06-23)
Profiling of miR-200b expression and its targets (transforming growth factor [TGF]-β2 and ZEB2) in the surgical rabbit congenital diaphragmatic hernia (DH) model before and after tracheal occlusion (TO). Thirty-eight timed-pregnant rabbits had left DH creation on gestational day (GD) 23.
Mary Patrice Eastwood et al.
Prenatal diagnosis, 38(9), 645-653 (2018-06-23)
Profiling of miR-200b expression and its targets (transforming growth factor [TGF]-β2 and ZEB2) in the surgical rabbit congenital diaphragmatic hernia (DH) model before and after tracheal occlusion (TO). Thirty-eight timed-pregnant rabbits had left DH creation on gestational day (GD) 23.

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico