Saltar al contenido
Merck
Todas las fotos(3)

Key Documents

SAB2108515

Sigma-Aldrich

Anti-TWIST1

IgG fraction of antiserum

Sinónimos:

Anti- ACS3, Anti- BPES2, Anti- BPES3, Anti- CRS1, Anti-SCS

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

IgG fraction of antiserum

tipo de anticuerpo

primary antibodies

clon

polyclonal

formulario

buffered aqueous solution

mol peso

21 kDa

reactividad de especies

bovine, mouse, rat, horse, pig, human

concentración

0.5-1 mg/mL

técnicas

immunoblotting: suitable
immunohistochemistry: suitable

nº de acceso

NM_000474

Nº de acceso UniProt

aplicaciones

research pathology

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... TWIST1(7291)

Inmunógeno

Synthetic peptide directed towards the C terminal region of human TWIST1

Acciones bioquímicas o fisiológicas

Basic helix-loop-helix (bHLH) transcription factors have been implicated in cell lineage determination and differentiation.TWIST1 is a bHLH transcription factor and shares similarity with another bHLH transcription factor, Dermo1. The strongest expression of this mRNA is in placental tissue; in adults, mesodermally derived tissues express this mRNA preferentially. Mutations in this gene have been found in patients with Saethre-Chotzen syndrome.

Secuencia

Synthetic peptide located within the following region: DKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVW

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Fangfang Li et al.
PloS one, 14(10), e0218839-e0218839 (2019-10-10)
PRR14 (Proline rich protein 14) was firstly identified for its ability to specify and localize heterochromatin during cell cycle progression. Aberrant expression of PRR14 is associated with the tumorigenesis and progression of lung cancer. However, its involvement in colon cancer

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico