SAB2108239

Anti-TNNT2 antibody produced in rabbit

affinity isolated antibody

• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Formulario: buffered aqueous solution
• mol peso: 35kDa
• reactividad de especies: mouse, guinea pig, rat, horse, sheep, rabbit, bovine, dog, human
• concentración: 0.5 mg - 1 mg/mL
• técnicas: immunoblotting: suitable
• Nº de acceso NCBI: NM_000364
• Nº de acceso UniProt: P45379
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... TNNT2(7139)

Descripción

Descripción general

The previously assigned protein identifier A2TDB9 has been merged into P45379. Full details can be found on the UniProt database.

Inmunógeno

Synthetic peptide directed towards the N terminal region of human TNNT2

Acciones bioquímicas o fisiológicas

TNNT2 is the tropomyosin-binding subunit of the troponin complex, which is located on the thin filament of striated muscles and regulates muscle contraction in response to alterations in intracellular calcium ion concentration. Mutations in the gene encoding TNNT2 have been associated with familial hypertrophic cardiomyopathy as well as with dilated cardiomyopathy. The protein encoded by this gene is the tropomyosin-binding subunit of the troponin complex, which is located on the thin filament of striated muscles and regulates muscle contraction in response to alterations in intracellular calcium ion concentration. Mutations in this gene have been associated with familial hypertrophic cardiomyopathy as well as with dilated cardiomyopathy. Transcripts for this gene undergo alternative splicing that results in many tissue-specific isoforms, however, the full-length nature of some of these variants has not yet been determined.

Secuencia

Synthetic peptide located within the following region: ESKPKPRSFMPNLVPPKIPDGERVDFDDIHRKRMEKDLNELQALIEAHFE

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable