Saltar al contenido
Merck
Todas las fotos(1)

Documentos clave

SAB2107115

Sigma-Aldrich

Anti-KRAS antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-C-K-RAS, Anti-CFC2, Anti-K-RAS2A, Anti-K-RAS2B, Anti-K-RAS4A, Anti-K-RAS4B, Anti-K-Ras, Anti-K-Ras 2, Anti-KRAS1, Anti-KRAS2, Anti-NS, Anti-NS3, Anti-OES, Anti-RALD, Anti-RASK2, Anti-c-Ki-ras, Anti-c-Ki-ras2

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
Todas las fotos(1)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

100

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

buffered aqueous solution

mol peso

20 kDa

reactividad de especies

human, rabbit, bovine, rat, guinea pig, horse, dog, mouse

concentración

0.5 mg - 1 mg/mL

técnicas

western blot: suitable

Nº de acceso NCBI

NM_031515

Nº de acceso UniProt

A0JN17

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... KRAS(3845)
rat ... Kras(24525)

Inmunógeno

The immunogen for anti-KRAS antibody: synthetic peptide derected towards the N terminal of human KRAS

Acciones bioquímicas o fisiológicas

Kras is a oncogene and member of the small GTPase superfamily.

Secuencia

Synthetic peptide located within the following region: QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVP

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number
QC25172

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

Busque por un COA

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Wulamujiang Aini et al.
Transplant immunology, 31(2), 55-59 (2014-07-06)
In living donor liver transplantation, the biological organ age of the donated allograft is unknown in young patients who receive grafts from older donors. Few studies have focused on the effects of aging on allografts in the state of tolerance.
Hua Yang et al.
Anti-cancer drugs, 25(7), 767-777 (2014-04-02)
Histone deacetylase inhibitors are a new class of anticancer agents that inhibit cancer cell proliferation and induce apoptosis and cell cycle arrest in various cancer cells. Recently, we identified ZYJ-34c, a modified histone deacetylase inhibitor that showed significantly higher antitumor
Maria Angelica Cortez et al.
Molecular therapy : the journal of the American Society of Gene Therapy, 22(8), 1494-1503 (2014-05-06)
The microRNA (miR)-200s and their negative regulator ZEB1 have been extensively studied in the context of the epithelial-mesenchymal transition. Loss of miR-200s has been shown to enhance cancer aggressiveness and metastasis, whereas replacement of miR-200 miRNAs has been shown to
Ki Hwan Kweon et al.
International journal of oncology, 45(5), 2065-2075 (2014-08-12)
Despite the favorable therapeutic outcomes reported in differentiated thyroid cancer (DTC), a significant proportion of DTC patients present with refractory behavior to conventional therapy. The sirtuin (Sirt) family has recently been implicated in the maintenance of cellular homeostasis under genotoxic
Joseph Carver et al.
PloS one, 9(8), e103836-e103836 (2014-08-06)
Mutations in the Ras family of small GTPases, particularly KRAS, occur at high frequencies in cancer and represent a major unmet therapeutic need due to the lack of effective targeted therapies. Past efforts directed at inhibiting the activity of the
Ver todos los artículos relacionados

Global Trade Item Number

Número de referencia del producto (SKU)GTIN
SAB2107115-100UL4061836113896
SAB2107115-50UG

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico