SAB2106779

Anti-VAMP7 antibody produced in rabbit

affinity isolated antibody

• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• formulario: buffered aqueous solution
• mol peso: 25 kDa
• reactividad de especies: mouse, bovine, rabbit, guinea pig, sheep, horse, dog, human, rat
• concentración: 0.5 mg - 1 mg/mL
• técnicas: western blot: suitable
• Nº de acceso NCBI: NM_011515
• Nº de acceso UniProt: P70280
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... VAMP7(6845) ; mouse ... Vamp7(20955)

Descripción

Inmunógeno

The immunogen for anti-VAMP7 antibody: synthetic peptide derected towards the C terminal of human VAMP7

Acciones bioquímicas o fisiológicas

Vamp7 is involved in the targeting and/or fusion of transport vesicles to their target membrane during transport of proteins from the early endosome to the lysosome. Vamp7 is required for heterotypic fusion of late endosomes with lysosomes and homotypic lysosomal fusion.Vamp7 is required for calcium regulated lysosomal exocytosis. Vamp7 is involved in the export of chylomicrons from the endoplasmic reticulum to the cis Golgi.Vamp7 is required for exocytosis of mediators during eosinophil and neutrophil degranulation, and target cell killing by natural killer cells. Vamp7 is also required for focal exocytosis of late endocytic vesicles during phagosome formation.

Secuencia

Synthetic peptide located within the following region: DELKGIMVRNIDLVAQRGERLELLIDKTENLVDSSVTFKTTSRNLARAMC

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable