SAB2104637

Anti-ATP7A antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-MK, Anti-MNK
• Número MDL: MFCD03455449
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• mol peso: 163 kDa
• reactividad de especies: horse, rat, human, mouse, dog, guinea pig, rabbit, bovine
• envase: pkg of 100 μL buffered aqueous solution; pkg of 50 μg lyophilized powder
• concentración: 0.5 mg - 1 mg/mL
• técnicas: western blot: suitable
• Nº de acceso NCBI: NM_000052
• Nº de acceso UniProt: Q04656
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... ATP7A(538)

Descripción

Inmunógeno

Synthetic peptide directed towards the middle region of human ATP7A

Acciones bioquímicas o fisiológicas

The ATP7A gene encodes the Menkes copper-translocating P-type ATPase, a ubiquitous protein that regulates the absorption of copper in the gastrointestinal tract. Inside cells, this protein has a dual function: it delivers copper to cuproenzymes in the Gol

Secuencia

Synthetic peptide located within the following region: SSLFLKLYRKPTYESYELPARSQIGQKSPSEISVHVGIDDTSRNSPKLGL

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable