SAB2104536

Anti-U2AF1, (N-terminal) antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-DKFZp313J1712, Anti-FP793, Anti-RN, Anti-RNU2AF1, Anti-U2AF35
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• formulario: buffered aqueous solution
• mol peso: 28 kDa
• reactividad de especies: dog, bovine, human, mouse, horse, rat, guinea pig, rabbit
• concentración: 0.5 mg - 1 mg/mL
• técnicas: western blot: suitable
• Nº de acceso NCBI: NM_001025203
• Nº de acceso UniProt: Q01081
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... U2AF1(7307)

Descripción

Descripción general

The previously assigned protein identifier Q701P4 has been merged into Q01081. Full details can be found on the UniProt database.

Inmunógeno

Synthetic peptide directed towards the N terminal region of human U2AF1

Acciones bioquímicas o fisiológicas

This gene belongs to the splicing factor SR family of genes. U2 auxiliary factor, comprising a large and a small subunit, is a non-snRNP protein required for the binding of U2 snRNP to the pre-mRNA branch site. This gene encodes the small subunit which pl

Secuencia

Synthetic peptide located within the following region: MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTILIQN

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable