SAB2104130

Anti-ASCL2 antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-ASH2, Anti-HASH2, Anti-MASH2
• Número MDL: MFCD07370257
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• formulario: buffered aqueous solution
• mol peso: 20 kDa
• reactividad de especies: human, rat, bovine, dog, guinea pig
• concentración: 0.5 mg - 1 mg/mL
• técnicas: western blot: suitable
• Nº de acceso NCBI: NM_005170
• Nº de acceso UniProt: Q99929
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... ASCL2(430)

Descripción

Descripción general

Achaete scute-like 2 (Ascl2) is a basic helix-loop-helix transcription factor. The base of small and large intestinal crypts and the placenta shows its expression. This gene is mapped to human chromosome 11p15.

Inmunógeno

Synthetic peptide directed towards the middle region of human ASCL2

Acciones bioquímicas o fisiológicas

Achaete scute-like 2 (Ascl2) is a downstream target of WNT signalling. It may act as a regulatory factor, which regulates the fate of colon cancer cells. Ascl2 is also accountable for the differentiation of the trophoblast lineage in normal placenta.

Secuencia

Synthetic peptide located within the following region: QALRQHVPHGGASKKLSKVETLRSAVEYIRALQRLLAEHDAVRNALAGGL

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable