Saltar al contenido
Merck
Todas las fotos(7)

Documentos clave

SAB2101526

Sigma-Aldrich

Anti-MTUS1 antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-ATIP, Anti-DKFZp586D1519, Anti-DKFZp686F20243, Anti-FLJ14295, Anti-Mitochondrial tumor suppressor 1

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

buffered aqueous solution

mol peso

141 kDa

reactividad de especies

dog, bovine, human

concentración

0.5 mg - 1 mg/mL

técnicas

immunohistochemistry: suitable
western blot: suitable

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... MTUS1(57509)

Inmunógeno

Synthetic peptide directed towards the middle region of human MTUS1

Acciones bioquímicas o fisiológicas

MTUS1 contains a C-terminal domain and is able to interact with the angiotension II (AT2) receptor and a large coiled-coil region allowing dimerization. One of the isoforms has been shown to be a mitochondrial protein that acts as a tumor suppressor and partcipates in AT2 signaling pathways. Other isoforms may be nuclear or transmembrane proteins but it has not been determined whether they also participate in AT2 signaling pathways. This gene encodes a protein which contains a C-terminal domain able to interact with the angiotension II (AT2) receptor and a large coiled-coil region allowing dimerization. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. One of the transcript variants has been shown to encode a mitochondrial protein that acts as a tumor suppressor and partcipates in AT2 signaling pathways. Other variants may encode nuclear or transmembrane proteins but it has not been determined whether they also participate in AT2 signaling pathways.

Secuencia

Synthetic peptide located within the following region: KRLSMENEELLWKLHNGDLCSPKRSPTSSAIPLQSPRNSGSFPSPSISPR

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico