SAB2101410

Anti-LZTR1 antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-Leucine-zipper-like transcription regulator 1, Anti-MGC21205, Anti-TCFL2
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• formulario: buffered aqueous solution
• mol peso: 95 kDa
• reactividad de especies: rabbit, dog, guinea pig, human, bovine, rat, mouse
• concentración: 0.5 mg - 1 mg/mL
• técnicas: western blot: suitable
• Nº de acceso UniProt: Q8N653
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... LZTR1(8216)

Descripción

Inmunógeno

Synthetic peptide directed towards the N terminal region of human LZTR1

Acciones bioquímicas o fisiológicas

Leucine-zipper-like transcriptional regulator 1(LZTR1) is belived to be a DNA-binding protein and transcriptional regulator based on its predicted structural characteristics. The transcript is present in several essential fetal organs and is hemizygously deleted in some DiGeorge syndrome patients. LZTR1 is thought to play a critical role in embryogenesis.This gene encodes a member of the BTB-kelch superfamily. Initially described as a putative transcriptional regulator based on weak homology to members of the basic leucine zipper-like family, the encoded protein subsequently has been shown to localize exclusively to the Golgi network where it may help stabilize the Gogli complex. Deletion of this gene may be associated with DiGeorge syndrome.

Secuencia

Synthetic peptide located within the following region: AGPGSTGGQIGAAALAGGARSKVAPSVDFDHSCSDSVEYLTLNFGPFETV

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable