SAB1412311

ANTI-HMGB2 antibody produced in mouse

clone 4G7, purified immunoglobulin, buffered aqueous solution

• Sinónimos: HMG2, HMGB2
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: mouse
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: 4G7, monoclonal
• Formulario: buffered aqueous solution
• mol peso: antigen 47.19 kDa
• reactividad de especies: human
• técnicas: indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotipo: IgG2aκ
• Nº de acceso NCBI: BC000903
• Nº de acceso UniProt: P26583
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... HMGB2(3148)

Descripción

Descripción general

High-mobility group protein B2, also known as high-mobility group protein 2 (HMG-2), is a protein encoded by the HMGB2 gene in humans. The protein belongs to a family of chromatin proteins made up of two basic DNA binding domains, HMG box A and B, and a C-terminal acidic tail. The gene is mapped to human chromosome 4q34.

Inmunógeno

HMGB2 (AAH00903.2, 1 a.a. ~ 195 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEE

Acciones bioquímicas o fisiológicas

High-mobility group protein B2 (HMGB2) functions as a significant prognostic factor and may play a crucial role in cell invasion. The gene acts as a novel prognostic marker and an attractive therapeutic target for glioblastoma multiforme (GBM). The protein helps in altering DNA elasticity while facilitating transcription, replication and DNA repair. It plays a significant role in tumor development and during prognosis of hepatocellular carcinoma (HCC). It may also be associated with the anti-apoptotic pathway.

Forma física

Solution in phosphate buffered saline, pH 7.4

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 12 - Non Combustible Liquids
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable