Todas las fotos(2)

Documentos clave

SAB1412193

ANTI-T antibody produced in mouse

Name: ANTI-T antibody produced in mouse
Brand: SIGMA

clone 5C8, purified immunoglobulin, buffered aqueous solution

Sinónimos:

MGC104817, T, TFT

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización

Todas las fotos(2)

About This Item

Código UNSPSC:

12352203

NACRES:

NA.41

origen biológico

mouse

Nivel de calidad

100

conjugado

unconjugated

forma del anticuerpo

purified immunoglobulin

tipo de anticuerpo

primary antibodies

clon

5C8, monoclonal

Formulario

buffered aqueous solution

mol peso

antigen 36.63 kDa

reactividad de especies

human

técnicas

indirect ELISA: suitable
western blot: 1-5 μg/mL

isotipo

IgG2aκ

Nº de acceso NCBI

NM_003181

Nº de acceso UniProt

O15178

Condiciones de envío

dry ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... T(6862)

Categorías relacionadas

Primary Antibodies

Descripción general

The protein encoded by this gene is an embryonic nuclear transcription factor that binds to a specific DNA element, the palindromic T-site. It binds through a region in its N-terminus, called the T-box, and effects transcription of genes required for mesoderm formation and differentiation. The protein is localized to notochord-derived cells. (provided by RefSeq)

Inmunógeno

T (NP_003172, 222 a.a. ~ 320 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
ERSDHKEMMEEPGDSQQPGYSQWGWLLPGTSTLCPPANPHPQFGGALSLPSTHSCDRYPTLRSHRSSPYPSPYAHRNNSPTYSDNSPACLSMLQSHDNW

Forma física

Solution in phosphate buffered saline, pH 7.4

¿No encuentra el producto adecuado?

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

08085-5C8

12174-S418

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

Busque por un COA

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Specific targeting of tau oligomers in Htau mice prevents cognitive impairment and tau toxicity following injection with brain-derived tau oligomeric seeds.

Diana L Castillo-Carranza et al.

Journal of Alzheimer's disease : JAD, 40 Suppl 1, S97-S111 (2014-03-08)

Neurodegenerative disease is one of the greatest health crises in the world and as life expectancy rises, the number of people affected will continue to increase. The most common neurodegenerative disease, Alzheimer's disease, is a tauopathy, characterized by the presence

Mononuclear phagocytes rapidly clear apoptotic epithelial cells in the proximal epididymis.

T B Smith et al.

Andrology, 2(5), 755-762 (2014-08-02)

We have shown previously that a network of mononuclear phagocytes (MPs) expressing macrophage and dendritic cell markers such as CD11c, F4/80 and CX3CR1, lines the base of the epididymal tubule. However, in the initial segment (IS) and only in that

Expression of organic osmolyte transporters in cultured rat astrocytes and rat and human cerebral cortex.

Jessica Oenarto et al.

Archives of biochemistry and biophysics, 560, 59-72 (2014-07-09)

This study characterizes the expression of the osmolyte transporters betaine/γ-amino-n-butyric acid (GABA) transporter (BGT-1), the taurine transporter (TauT) and the sodium-dependent myo-inositol transporter (SMIT) in various rat brain cells in culture and in rat and human cerebral cortex in situ.

Serotonin 2A receptor regulates microtubule assembly and induces dynamics of dendritic growth cones in rat cortical neurons in vitro.

Akiko Ohtani et al.

Neuroscience research, 81-82, 11-20 (2014-04-05)

Serotonin (5-HT) regulates the development of cerebral cortex, but 5-HT receptors mediating the effects are poorly understood. We investigated roles of 5-HT2A receptor in dendritic growth cones using dissociation culture of rat cerebral cortex. Neurons at embryonic day 16 were

Cell cycle-dependent phosphorylation of Theileria annulata schizont surface proteins.

Olga Wiens et al.

PloS one, 9(7), e103821-e103821 (2014-08-01)

The invasion of Theileria sporozoites into bovine leukocytes is rapidly followed by the destruction of the surrounding host cell membrane, allowing the parasite to establish its niche within the host cell cytoplasm. Theileria infection induces host cell transformation, characterised by

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico