SAB1412165

ANTI-BTG2 antibody produced in mouse

clone 1B8, purified immunoglobulin, buffered aqueous solution

• Sinónimos: BTG2, MGC126063, MGC126064, PC3, TIS21
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• Nivel de calidad: 100
• origen biológico: mouse
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: 1B8, monoclonal
• formulario: buffered aqueous solution
• mol peso: antigen 36.74 kDa
• reactividad de especies: human
• técnicas: indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotipo: IgG1κ
• Nº de acceso NCBI: NM_006763
• Nº de acceso UniProt: P78543
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... BTG2(7832)

Descripción

Descripción general

The protein encoded by this gene is a member of the BTG/Tob family. This family has structurally related proteins that appear to have antiproliferative properties. This encoded protein is involved in the regulation of the G1/S transition of the cell cycle. (provided by RefSeq)

Inmunógeno

BTG2 (NP_006754, 59 a.a. ~ 158 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PSKGSGYRCIRINHKMDPIISRVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICVLYEEAPLAASCGLLTCKNQVLLGRSSPSKNYVMAVSS

Forma física

Solution in phosphate buffered saline, pH 7.4

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable