SAB1412154

ANTI-LHX6 antibody produced in mouse

clone 2A2, purified immunoglobulin, buffered aqueous solution

• Sinónimos: LHX6, LHX6.1, MGC119542, MGC119544, MGC119545
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: mouse
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: 2A2, monoclonal
• formulario: buffered aqueous solution
• mol peso: antigen 35.64 kDa
• reactividad de especies: human
• técnicas: indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotipo: IgG2aκ
• Nº de acceso NCBI: NM_014368
• Nº de acceso UniProt: Q9UPM6
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... LHX6(26468)

Descripción

Descripción general

This gene encodes a member of a large protein family that contains the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein may function as a transcriptional regulator and may be involved in the control of differentiation and development of neural and lymphoid cells. Two alternatively spliced transcript variants encoding distinct isoforms have been described for this gene. Alternatively spliced transcript variants have been identified, but their biological validity has not been determined. (provided by RefSeq)

Inmunógeno

LHX6 (NP_055183, 274 a.a. ~ 363 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
HKKHTPQHPVPPSGAPPSRLPSALSDDIHYTPFSSPERARMVTLHGYIESQVQCGQVHCRLPYTAPPVHLKADMDGPLSNRGEKVILFQY

Forma física

Solution in phosphate buffered saline, pH 7.4

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable