SAB1410391

Anti-LPHN1 antibody produced in rabbit

purified immunoglobulin, buffered aqueous solution

• Sinónimos: CIRL1, CL1, LEC2
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• formulario: buffered aqueous solution
• mol peso: antigen 20.8 kDa
• reactividad de especies: human
• técnicas: western blot: 1 μg/mL
• Nº de acceso NCBI: BC019928
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... LPHN1(22859)

Descripción

Descripción general

This gene encodes a member of the latrophilin subfamily of G-protein coupled receptors (GPCR). Latrophilins may function in both cell adhesion and signal transduction. In experiments with non-human species, endogenous proteolytic cleavage within a cysteine-rich GPS (G-protein-coupled-receptor proteolysis site) domain resulted in two subunits (a large extracellular N-terminal cell adhesion subunit and a subunit with substantial similarity to the secretin/calcitonin family of GPCRs) being non-covalently bound at the cell membrane. Latrophilin-1 has been shown to recruit the neurotoxin from black widow spider venom, alpha-latrotoxin, to the synapse plasma membrane. Alternative splicing results in multiple variants encoding distinct isoforms

Inmunógeno

LPHN1 (AAH19928.1, 1 a.a. ~ 201 a.a) full-length human protein.

Sequence
MGLISHLERLMAEGKWGGTGVVEGMGMAEEGAGNGKAVWGMGRGKGERSPSLSSTFPQGRRSQVPGLGSGHPCSGRLDPKSQTPEAPGSGCVLSTCPGPLLSSLSGQPPQPPSLNSRGSIAPGHPSPAPALPFPQRWPLHLCSDLSPSLCPSFSHKCHEFSNIFGSQPAAAMNFVGLRGRGSRKELGGRGQVGGWRDPFCC

Forma física

Solution in phosphate buffered saline, pH 7.4

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable