SAB1410343

Anti-STX2 antibody produced in rabbit

purified immunoglobulin, buffered aqueous solution

• Sinónimos: EPIM, EPM, MGC51014, STX2A, STX2B, STX2C
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Formulario: buffered aqueous solution
• mol peso: antigen 33.3 kDa
• reactividad de especies: human
• técnicas: western blot: 1 μg/mL
• Nº de acceso NCBI: NM_001980.2
• Nº de acceso UniProt: P32856
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... STX2(2054)

Descripción

Descripción general

Syntaxin 2 (STX2) is encoded by the gene mapped to human chromosome 12q24.33. The encoded protein is ubiquitously expressed and is mainly localized to plasma membrane. STX2 is a member of the soluble N-ethylmaleimide-sensitive factor activating protein receptor (SNARE) membrane fusion machinery.

The product of this gene belongs to the syntaxin/epimorphin family of proteins. The syntaxins are a large protein family implicated in the targeting and fusion of intracellular transport vesicles. The product of this gene regulates epithelial-mesenchymal interactions and epithelial cell morphogenesis and activation. Alternatively spliced transcript variants encoding different isoforms have been identified. (provided by RefSeq)

Inmunógeno

STX2 (NP_001971.2, 1 a.a. ~ 287 a.a) full-length human protein.

Sequence
MRDRLPDLTACRKNDDGDTVVVVEKDHFMDDFFHQVEEIRNSIDKITQYVEEVKKNHSIILSAPNPEGKIKEELEDLNKEIKKTANKIRAKLKAIEQSFDQDESGNRTSVDLRIRRTQHSVLSRKFVEAMAEYNEAQTLFRERSKGRIQRQLEITGRTTTDDELEEMLESGKPSIFTSDIISDSQITRQALNEIESRHKDIMKLETSIRELHEMFMDMAMFVETQGEMINNIERNVMNATDYVEHAKEETKKAIKYQSKARRKLMFIIICVIVLLVILGIILATTLS

Acciones bioquímicas o fisiológicas

Syntaxin 2 (STX2) plays a vital role in expression, production and release of tissue plasminogen activator (tPA) protein. In mammalian cells, STX2 facilitates the fusion event required for cytokinesis. Deletion in the STX2 gene might be responsible for defective testicular development.

Forma física

Solution in phosphate buffered saline, pH 7.4

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable