SAB1408077

Anti-SYT16 antibody produced in mouse

purified immunoglobulin, buffered aqueous solution

• Sinónimos: CHR14SYT, SYT14L, Strep14, syt14r, yt14r
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: mouse
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• formulario: buffered aqueous solution
• mol peso: antigen ~22.8 kDa
• reactividad de especies: human
• técnicas: western blot: 1 μg/mL
• Nº de acceso NCBI: BC040924
• Nº de acceso UniProt: Q17RD7
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... SYT16(83851)

Descripción

Descripción general

Mouse polyclonal antibody raised against a full-length human SYT16 protein.

SYT16 (synaptotagmin XVI) is a putative membrane trafficking protein belonging to the synaptotagmin (Syt) gene family. It is composed of a single N-terminal transmembrane domain and a putative fatty-acylation region adjacent to the transmembrane domain.

Inmunógeno

SYT16 (AAH40924.1, 1 a.a. ~ 203 a.a) full-length human protein.

Sequence
MTRERMMGEKLFYLSHLHPEGEMKVTLVLEPRSNISSGGSPLSPSAVSHSDSTSSTQSLSHGGAPELLVGLSYNATTGRLSVEMIKGSHFRNLAVNRAPDTYGKLFLLNSVGQEMSRCKTSIRRGQPNPVYKETFVFQVALFQLSDVTLMISVYNRRTMKRKEMIGWIALGQNSSGEEEQDHWEEMKETKGQQICRWHTLLES

Aplicación

Anti-SYT16 antibody produced in mouse is suitable for wstern blot analysis.

Acciones bioquímicas o fisiológicas

The activity of SYT16 (synaptotagmin XVI) is dependent on the Ca(2+) similar to all the members of Syt family proteins. It forms Ca(2+) independent oligomer. It may be involved in membrane and vesicular trafficking in specific tissues outside the brain.

Forma física

Solution in phosphate buffered saline, pH 7.4

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable