SAB1406209

Anti-P2RX5 antibody produced in mouse

purified immunoglobulin, buffered aqueous solution

• Sinónimos: MGC47755, P2X5, P2X5R
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: mouse
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Formulario: buffered aqueous solution
• mol peso: antigen ~47.2 kDa
• reactividad de especies: human
• técnicas: western blot: 1 μg/mL
• Nº de acceso NCBI: NM_002561.2
• Nº de acceso UniProt: Q93086
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... P2RX5(5026)

Descripción

Descripción general

The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel. Several characteristic motifs of ATP-gated channels are present in its primary structure, but, unlike other members of the purinoceptors family, this receptor has only a single transmembrane domain. Three transcript variants encoding distinct isoforms have been identified for this gene. (provided by RefSeq)

Inmunógeno

P2RX5 (NP_002552.2, 1 a.a. ~ 422 a.a) full-length human protein.

Sequence
MGQAGCKGLCLSLFDYKTEKYVIAKNKKVGLLYRLLQASILAYLVVWVFLIKKGYQDVDTSLQSAVITKVKGVAFTNTSDLGQRIWDVADYVIPAQGENVFFVVTNLIVTPNQRQNVCAENEGIPDGACSKDSDCHAGEAVTAGNGVKTGRCLRRENLARGTCEIFAWCPLETSSRPEEPFLKEAEDFTIFIKNHIRFPKFNFSKSNVMDVKDRSFLKSCHFGPKNHYCPIFRLGSVIRWAGSDFQDIALEGGVIGINIEWNCDLDKAASECHPHYSFSRLDNKLSKSVSSGYNFRFARYYRDAAGVEFRTLMKAYGIRFDVMVNGKGAFFCDLVLIYLIKKREFYRDKKYEEVRGLEDSSQEAEDEASGLGLSEQLTSGPGLLGMPEQQELQEPPEAKRGSSSQKGNGSVCPQLLEPHRST

Aplicación

Anti-P2RX5 antibody produced in mouse is suitable for western blot.

Acciones bioquímicas o fisiológicas

P2RX5 (Purinergic receptor P2X, ligand-gated ion channel, 5) functions as a ATP-gated ion channel. In humans, it is predicted to form trimeric structure with another member of this family, P2X1. Upregulated P2RX5 expression has been observed during CD4⁺ T cell activation. It has been studied that activated P2RX5 plays an important role in the T cell polarity and immunoregulation, when it is recruited to the surface of the activated CD4⁺ T cells.

Forma física

Solution in phosphate buffered saline, pH 7.4

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable