SAB1405869

Anti-GIF antibody produced in mouse

purified immunoglobulin, buffered aqueous solution

• Sinónimos: IF, IFMH, INF, TCN3
• Código UNSPSC: 12352203
• NACRES: NA.41
• conjugado: unconjugated
• application: WB
• clon: polyclonal
• reactividad de especies: human
• citations: 2
• técnicas: western blot: 1 μg/mL

Propiedades

• origen biológico: mouse
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Formulario: buffered aqueous solution
• mol peso: antigen ~45.4 kDa
• reactividad de especies: human
• técnicas: western blot: 1 μg/mL
• Nº de acceso NCBI: NM_005142.2
• Nº de acceso UniProt: P27352
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... GIF(2694)

Descripción

Descripción general

Gastric intrinsic factor (GIF), also known as intrinsic factor, is a fucosylated protein.

Inmunógeno

GIF (NP_005133.2, 1 a.a. ~ 417 a.a) full-length human protein.

Sequence
MAWFALYLLSLLWATAGTSTQTQSSCSVPSAQEPLVNGIQVLMENSVTSSAYPNPSILIAMNLAGAYNLKAQKLLTYQLMSSDNNDLTIGQLGLTIMALTSSCRDPGDKVSILQRQMENWAPSSPNAEASAFYGPSLAILALCQKNSEATLPIAVRFAKTLLANSSPFNVDTGAMATLALTCMYNKIPVGSEEGYRSLFGQVLKDIVEKISMKIKDNGIIGDIYSTGLAMQALSVTPEPSKKEWNCKKTTDMILNEIKQGKFHNPMSIAQILPSLKGKTYLDVPQVTCSPDHEVQPTLPSNPGPGPTSASNITVIYTINNQLRGVELLFNETINVSVKSGSVLLVVLEEAQRKNPMFKFETTMTSWGLVVSSINNIAENVNHKTYWQFLSGVTPLNEGVADYIPFNHEHITANFTQY

Acciones bioquímicas o fisiológicas

Gastric intrinsic factor (GIF) has a role in maintaining the plasma levels of vitamin B12. It is crucial for vitamin B12 absorption, transport and storage.

Forma física

Solution in phosphate buffered saline, pH 7.4

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable