SAB1405057

Monoclonal Anti-PSAT1, (C-terminal) antibody produced in mouse

clone 1C2, ascites fluid

• Sinónimos: EPIP, MGC1460, PSA, PSAT
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: mouse
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: ascites fluid
• tipo de anticuerpo: primary antibodies
• clon: 1C2, monoclonal
• mol peso: antigen ~38.1 kDa
• reactividad de especies: human
• técnicas: indirect ELISA: suitable; western blot: 1:500-1:1000
• isotipo: IgG2bκ
• Nº de acceso NCBI: NM_058179
• Nº de acceso UniProt: Q9Y617
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... PSAT1(29968)

Descripción

Descripción general

The protein encoded by this gene is likely a phosphoserine aminotransferase, based on similarity to proteins in mouse, rabbit, and Drosophila. Alternative splicing of this gene results in two transcript variants encoding different isoforms. (provided by RefSeq)

Inmunógeno

PSAT1 (NP_478059, 262 a.a. ~ 370 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
GGAAAMEKLSSIKSQTIYEIIDNSQGFYVCPVEPQNRSKMNIPFRIGNAKGDDALEKRFLDKALELNMLSLKGHRSVGGIRASLYNAVTIEDVQKLAAFMKKFLEMHQL

Forma física

Clear solution

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 11 - Combustible Solids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable