SAB1404652

Monoclonal Anti-CACNA1I antibody produced in mouse

clone 2F5, purified immunoglobulin, buffered aqueous solution

• Sinónimos: Cav3.3, KIAA1120
• Código UNSPSC: 12352203
• NACRES: NA.41
• clon: 2F5, monoclonal
• application: ELISA (i); WB
• reactividad de especies: human
• técnicas: indirect ELISA: suitable; western blot: 1-5 μg/mL

Propiedades

• origen biológico: mouse
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: 2F5, monoclonal
• Formulario: buffered aqueous solution
• mol peso: antigen ~37 kDa
• reactividad de especies: human
• técnicas: indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotipo: IgG1κ
• Nº de acceso NCBI: NM_021096
• Nº de acceso UniProt: Q9P0X4
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... CACNA1I(8911)

Descripción

Descripción general

Voltage-dependent calcium channels control the rapid entry of Ca(2+) into a variety of cell types and are therefore involved in both electrical and cellular signaling. T-type channels, such as CACNA1I, are activated by small membrane depolarizations and can generate burst firing and pacemaker activity.[supplied by OMIM

Inmunógeno

CACNA1I (NP_066919, 233 a.a. ~ 331 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
GLLRNRCFLEENFTIQGDVALPPYYQPEEDDEMPFICSLSGDNGIMGCHEIPPLKEQGRECCLSKDDVYDFGAGRQDLNASGLCVNWNRYYNVCRTGSA

Forma física

Solution in phosphate buffered saline, pH 7.4

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable