SAB1404563

Monoclonal Anti-EPM2A antibody produced in mouse

clone 4A12, purified immunoglobulin, buffered aqueous solution

• Sinónimos: EPM2, MELF
• Código UNSPSC: 12352203
• NACRES: NA.41
• conjugado: unconjugated
• application: ELISA (c); ELISA (i); WB
• clon: 4A12, monoclonal
• reactividad de especies: human, rat
• técnicas: capture ELISA: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL

Propiedades

• origen biológico: mouse
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: 4A12, monoclonal
• Formulario: buffered aqueous solution
• mol peso: antigen ~37 kDa
• reactividad de especies: human, rat
• técnicas: capture ELISA: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotipo: IgG2aκ
• Nº de acceso NCBI: NM_001018041
• Nº de acceso UniProt: O95278
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... EPM2A(7957)

Descripción

Descripción general

This gene encodes a dual-specificity phosphatase that associates with polyribosomes. The encoded protein may be involved in the regulation of glycogen metabolism. Mutations in this gene have been associated with myoclonic epilepsy of Lafora. Alternative splicing results in multiple transcript variants. (provided by RefSeq)

Inmunógeno

EPM2A (NP_001018051, 101 a.a. ~ 199 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
GNGPHHDRCCTYNENNLVDGVYCLPIGHWIEATGHTNEMKHTTDFYFNIAGHQAMHYSRILPNIWLGSCPRQVEHVTIKLKHELGITAVMNFQTEWDIV

Forma física

Solution in phosphate buffered saline, pH 7.4

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable