SAB1403953

Monoclonal Anti-HTR2B antibody produced in mouse

clone 4F3, purified immunoglobulin, buffered aqueous solution

• Sinónimos: 5-HT(2B), 5-HT2B
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: mouse
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: 4F3, monoclonal
• Formulario: buffered aqueous solution
• mol peso: antigen ~43.82 kDa
• reactividad de especies: human
• técnicas: indirect ELISA: suitable
• isotipo: IgG2bκ
• Nº de acceso NCBI: BC063123
• Nº de acceso UniProt: P41595
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... HTR2B(3357)

Descripción

Descripción general

Multiple receptor subtypes of serotonin neurotransmitters with multiple physiologic functions have been recognized. The 5-HT-2 receptors mediate many of the central and peripheral physiologic functions of serotonin. Cardiovascular effects include contraction of blood vessels and shape changes in platelets; central nervous system effects include neuronal sensitization to tactile stimuli and mediation of hallucinogenic effects of phenylisopropylamine hallucinogens.[supplied by OMIM

Inmunógeno

HTR2B (AAH63123.1, 199 a.a. ~ 359 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
VDNPNNITCVLTKERFGDFMLFGSLAAFFTPLAIMIVTYFLTIHALQKKAYLVKNKPPQRLTWLTVSTVFQRDETPCSSPEKVAMLDGSRKDKALPNSGDETLMRRTSTIGKKSVQTISNEQRASKVLGIVFFLFLLMWCPFFITNITLVLCDSCNQTTLQ

Forma física

Solution in phosphate buffered saline, pH 7.4

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable