Saltar al contenido
Merck
Todas las fotos(4)

Key Documents

SAB1403798

Sigma-Aldrich

Monoclonal Anti-F3 antibody produced in mouse

clone 4G4, ascites fluid

Sinónimos:

CD142, TF, TFA

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
Todas las fotos(4)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

mouse

Nivel de calidad

100

conjugado

unconjugated

forma del anticuerpo

ascites fluid

tipo de anticuerpo

primary antibodies

clon

4G4, monoclonal

mol peso

antigen ~38.21 kDa

reactividad de especies

human

técnicas

indirect ELISA: suitable
western blot: 1:500-1:1000

isotipo

IgG2aκ

Nº de acceso NCBI

BC011029

Nº de acceso UniProt

P13726

Condiciones de envío

dry ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... F3(2152)

Descripción general

This gene encodes coagulation factor III which is a cell surface glycoprotein. This factor enables cells to initiate the blood coagulation cascades, and it functions as the high-affinity receptor for the coagulation factor VII. The resulting complex provides a catalytic event that is responsible for initiation of the coagulation protease cascades by specific limited proteolysis. Unlike the other cofactors of these protease cascades, which circulate as nonfunctional precursors, this factor is a potent initiator that is fully functional when expressed on cell surfaces. There are 3 distinct domains of this factor: extracellular, transmembrane, and cytoplasmic. This protein is the only one in the coagulation pathway for which a congenital deficiency has not been described. (provided by RefSeq)

Inmunógeno

F3 (AAH11029, 45 a.a. ~ 154 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
TWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTK

Forma física

Clear solution

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

11 - Combustible Solids

Clase de riesgo para el agua (WGK)

WGK 1

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Takayuki Okamoto et al.
Atherosclerosis, 236(2), 430-437 (2014-08-30)
Endothelial cell (EC) interacts with adjacent EC through gap junction, and abnormal expression or function of Cxs is associated with cardiovascular diseases. In patients with endothelial dysfunction, the up-regulation of tissue factor (TF) expression promotes the pathogenic activation of blood
Jin Yang et al.
Human molecular genetics, 23(13), 3445-3455 (2014-02-06)
While the past decade has seen great progress in mapping loci for common diseases, studying how these risk alleles lead to pathology remains a challenge. Age-related macular degeneration (AMD) affects 9 million older Americans, and is characterized by the loss
U Andergassen et al.
Histology and histopathology, 29(7), 913-923 (2014-01-09)
Disseminated tumour cells (DTCs) in the bone marrow derive from many primary tumours, such as breast cancer. Their mere existence hints to present or future metastasis and implicates a worse prognosis for the patient. DTCs may possess different characteristics in

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico