SAB1403768

Monoclonal Anti-MARK2 antibody produced in mouse

clone 3C5, purified immunoglobulin, buffered aqueous solution

• Sinónimos: EMK1, MGC99619, PAR-1, Par1b
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: mouse
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: 3C5, monoclonal
• formulario: buffered aqueous solution
• mol peso: antigen ~37 kDa
• reactividad de especies: human
• técnicas: immunofluorescence: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotipo: IgG2aκ
• Nº de acceso NCBI: BC008771
• Nº de acceso UniProt: Q7KZI7
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... MARK2(2011)

Descripción

Descripción general

This gene encodes a member of the Par-1 family of serine/threonine protein kinases. The protein is an important regulator of cell polarity in epithelial and neuronal cells, and also controls the stability of microtubules through phosphorylation and inactivation of several microtubule-associating proteins. The protein localizes to cell membranes. Multiple transcript variants encoding different isoforms have been found for this gene. (provided by RefSeq)

Inmunógeno

MARK2 (AAH08771, 401 a.a. ~ 500 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QAAGPAIPTSNSYSKKTQSNNAENKRPEEDRESGRKASSTAKVPASPLPGLERKKTTPTPSTNSVLSTSTNRSRNSPLLERASLGQASIQNGKDSLTMPG

Forma física

Solution in phosphate buffered saline, pH 7.4

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable