SAB1403612

Monoclonal Anti-BMP8B antibody produced in mouse

clone 6D6, ascites fluid

• Sinónimos: BMP8, MGC131757, OP2
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: mouse
• conjugado: unconjugated
• forma del anticuerpo: ascites fluid
• tipo de anticuerpo: primary antibodies
• clon: 6D6, monoclonal
• mol peso: antigen ~35.9 kDa
• reactividad de especies: human
• técnicas: indirect ELISA: suitable; western blot: 1:500-1:1000
• isotipo: IgG2aκ
• Nº de acceso NCBI: NM_001720
• Nº de acceso UniProt: P34820
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... BMP8B(656)

Descripción

Descripción general

The bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bone growth. Many BMPs are part of the transforming growth factor-beta (TGFB) superfamily. BMPs were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. Based on its expression early in embryogenesis, the BMP encoded by this gene has a proposed role in early development. In addition, the fact that this BMP is closely related to BMP5 and BMP7 has led to speculation of possible bone inductive activity. (provided by RefSeq)

Inmunógeno

BMP8B (NP_001711, 274 a.a. ~ 362 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
KKSNELPQANRLPGIFDDVHGSHGRQVCRRHELYVSFQDLGWLDWVIAPQGYSAYYCEGECSFPLDSCMNATNHAILQSLVHLMMPDAV

Forma física

Clear solution

Información de seguridad

• Código de clase de almacenamiento: 11 - Combustible Solids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable