SAB1403533

Monoclonal Anti-NR0B1, (C-terminal) antibody produced in mouse

clone 2F12, purified immunoglobulin, buffered aqueous solution

• Sinónimos: AHC, AHCH, AHX, DAX-1, DAX1, DSS, GTD, HHG, NROB1
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: mouse
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: 2F12, monoclonal
• formulario: buffered aqueous solution
• mol peso: antigen ~38.21 kDa
• reactividad de especies: human
• técnicas: capture ELISA: suitable; indirect ELISA: suitable; indirect immunofluorescence: suitable
• isotipo: IgG2aκ
• Nº de acceso NCBI: NM_000475
• Nº de acceso UniProt: P51843
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... NR0B1(190)

Descripción

Descripción general

Nuclear receptor subfamily 0 group B member 1 (NR0B1), also known as dosage-sensitive sex-reversal, adrenal hypoplasia congenital critical region on the X chromosome, protein 1 (DAX1), is an orphan nuclear receptor. The gene encoding this 470-amino acid protein consists of two exons. The protein possesses a carboxy-terminal domain (CTD) and an amino-terminal domain (NTD) which has three short repeats, each containing an LXXLL motif. NR0B1 is expressed in the anterior pituitary, hypothalamus, adrenal cortex and gonads. The gene is localized on human chromosome Xp21.

Inmunógeno

NR0B1 (NP_000466, 361 a.a. ~ 470 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
IKCFLSKCWSLNISTKEYAYLKGTVLFNPDVPGLQCVKYIQGLQWGTQQILSEHTRMTHQGPHDRFIELNSTLFLLRFINANVIAELFFRPIIGTVSMDDMMLEMLCTKI

Acciones bioquímicas o fisiológicas

Nuclear receptor subfamily 0 group B member 1 (NR0B1) has adrenal and reproductive functions. It acts as a repressor of gene transcription. The protein inhibits the functioning of steroidogenic factor 1 (SF-1), an orphan nuclear receptor. Mutations in the NR0B1 gene have been associated with X-linked adrenal hypoplasia congenita and hypogonadotropic hypogonadism.

Forma física

Solution in phosphate buffered saline, pH 7.4

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable