SAB1403365

Monoclonal Anti-BIRC7, (N-terminal) antibody produced in mouse

clone 3H1, purified immunoglobulin, buffered aqueous solution

• Sinónimos: KIAP, LIVIN, ML-IAP, MLIAP, RNF50
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: mouse
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: 3H1, monoclonal
• formulario: buffered aqueous solution
• mol peso: antigen ~36.01 kDa
• reactividad de especies: human
• técnicas: capture ELISA: suitable; immunofluorescence: suitable; indirect ELISA: suitable
• isotipo: IgG2aκ
• Nº de acceso NCBI: NM_139317
• Nº de acceso UniProt: Q96CA5
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... BIRC7(79444)

Descripción

Descripción general

The protein encoded by this gene is a member of the family of inhibitor of apoptosis proteins (IAP) and contains a single copy of a baculovirus IAP repeat (BIR) as well as a RING-type zinc finger domain. The BIR domain is essential for inhibitory activity and interacts with caspases, while the RING finger domain sometimes enhances antiapoptotic activity but does not inhibit apoptosis alone. Two transcript variants encoding different isoforms have been found for this gene. The two isoforms have different antiapoptotic properties, with isoform alpha protecting cells from apoptosis induced by staurosporine and isoform b protecting cells from apoptosis induced by etoposide. (provided by RefSeq)

Inmunógeno

BIRC7 (NP_647478.1, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MGPKDSAKCLHRGPQPSHWAAGDGPTQERCGPRSLGSPVLGLDTCRAWDHVDGQILGQLRPLTEEEEEEGAGATLSRGPAFPGMGSEELR

Forma física

Solution in phosphate buffered saline, pH 7.4

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable