SAB1403099

Monoclonal Anti-SBLF antibody produced in mouse

clone 1F3, purified immunoglobulin, buffered aqueous solution

• Sinónimos: DKFZp781K2462, MGC149803, MGC149804, SBLF, STN1, STNB1, stoned-b1
• Código UNSPSC: 12352203
• NACRES: NA.41
• conjugado: unconjugated
• application: ELISA (c); ELISA (i); IF
• clon: 1F3, monoclonal
• reactividad de especies: human
• técnicas: capture ELISA: suitable; immunofluorescence: suitable; indirect ELISA: suitable

Propiedades

• origen biológico: mouse
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: 1F3, monoclonal
• Formulario: buffered aqueous solution
• mol peso: antigen ~36.23 kDa
• reactividad de especies: human
• técnicas: capture ELISA: suitable; immunofluorescence: suitable; indirect ELISA: suitable
• isotipo: IgG2aκ
• Nº de acceso NCBI: NM_006873
• Nº de acceso UniProt: Q9Y6Q2
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... STON1(11037)

Descripción

Descripción general

Endocytosis of cell surface proteins is mediated by a complex molecular machinery that assembles on the inner surface of the plasma membrane. This gene encodes one of two human homologs of the Drosophila melanogaster stoned B protein. This protein is related to components of the endocytic machinery and exhibits a modular structure consisting of an N-terminal proline-rich domain, a central region of homology specific to the human stoned B-like proteins, and a C-terminal region homologous to the mu subunits of adaptor protein (AP) complexes. Co-transcription of this gene and the neighboring downstream gene generates a rare transcript (SALF), which encodes a fusion protein comprised of sequence sharing identity with each individual gene product. (provided by RefSeq)

Inmunógeno

SBLF (NP_006864, 529 a.a. ~ 620 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SLKSVVVVQGAYVELQAFVNMASLAQRSSYAGSLRSCDNIRIHFPVPSQWIKALWTMNLQRQKSLKAKMNRRACLGSLQELESEPVIQVTVG

Forma física

Solution in phosphate buffered saline, pH 7.4

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable