SAB1402920

Monoclonal Anti-SLC5A3 antibody produced in mouse

clone 3A6, purified immunoglobulin, buffered aqueous solution

• Sinónimos: SMIT, SMIT2
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: mouse
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: 3A6, monoclonal
• formulario: buffered aqueous solution
• mol peso: antigen ~38.1 kDa
• reactividad de especies: human
• técnicas: capture ELISA: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotipo: IgG1κ
• Nº de acceso NCBI: NM_006933
• Nº de acceso UniProt: P53794
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... SLC5A3(6526)

Descripción

Descripción general

Solute carrier family 5 member 3 (SLC5A3) is a member of SLC5A gene family, which shares five transmembrane segment inverted repeats of the LeuT structural family. SLC5A3 is expressed in brain, kidney and placenta. SLC5A3 gene is located on human chromosome 21q22.11.

Inmunógeno

SLC5A3 (NP_008864, 533 a.a. ~ 641 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
TPPPTKEQIRTTTFWSKKNLVVKENCSPKEEPYKMQEKSILRCSENNETINHIIPNGKSEDSIKGLQPEDVNLLVTCREEGNPVASLGHSEAETPVDAYSNGQAALMGE

Aplicación

Monoclonal Anti-SLC5A3 antibody produced in mouse has been used in dSTORM (direct stochastic optical reconstruction microscopy).

Acciones bioquímicas o fisiológicas

Solute carrier family 5 member 3 (SLC5A3) functions in cellular osmoregulation. Overexpression of SLC5A3 contributes to pathophysiology of Down syndrome. SLC5A3 acts as a transporter in hypotonic volume regulation of mammalian cells. SLC5A3 regulates millimolar intracellular concentrations of myo-inositol and promotes transepithelial myo-inositol transport in kidney, intestine, retina and choroid plexus.

Forma física

Solution in phosphate buffered saline, pH 7.4

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable