SAB1402916

Monoclonal Anti-SIPA1, (C-terminal) antibody produced in mouse

clone 2B4, ascites fluid

• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: mouse
• conjugado: unconjugated
• forma del anticuerpo: ascites fluid
• tipo de anticuerpo: primary antibodies
• clon: 2B4, monoclonal
• mol peso: antigen ~38.1 kDa
• reactividad de especies: human
• técnicas: indirect ELISA: suitable
• isotipo: IgG1κ
• Nº de acceso NCBI: BC010492
• Nº de acceso UniProt: Q96FS4
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... SIPA1(6494)

Descripción

Descripción general

The product of this gene is a mitogen induced GTPase activating protein (GAP). It exhibits a specific GAP activity for Ras-related regulatory proteins Rap1 and Rap2, but not for Ran or other small GTPases. This protein may also hamper mitogen-induced cell cycle progression when abnormally or prematurely expressed. It is localized to the perinuclear region. Two alternatively spliced variants encoding the same isoform have been characterized to date. (provided by RefSeq)

Inmunógeno

SIPA1 (AAH10492, 933 a.a. ~ 1042 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SEIASTCNTILESLSREGQPIPESGDPKGTPKSDAEPEPGNLSEKVSHLESMLRKLQEDLQKEKADRAALEEEVRSLRHNNRRLQAESESAATRLLLASKQLGSPTADLA

Forma física

Clear solution

Información de seguridad

• Código de clase de almacenamiento: 11 - Combustible Solids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable