SAB1402857

Monoclonal Anti-NELL2 antibody produced in mouse

clone 1F6, purified immunoglobulin, buffered aqueous solution

• Sinónimos: NRP2
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: mouse
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: 1F6, monoclonal
• formulario: buffered aqueous solution
• mol peso: antigen ~37.11 kDa
• reactividad de especies: human
• técnicas: capture ELISA: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotipo: IgG2bκ
• Nº de acceso NCBI: NM_006159
• Nº de acceso UniProt: Q99435
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... NELL2(4753)

Descripción

Descripción general

The protein encoded by this gene is a glycoprotein containing several von Willebrand factor C domains and epidermal growth factor (EGF)-like domains. The encoded protein acts as a homotrimer and is found in the cytoplasm. Several variants encoding a few different isoforms exist, and at least one isoform appears to be a secreted protein. Studies in mouse suggest that this protein plays a role in neural cell growth and differentiation as well as in oncogenesis. (provided by RefSeq)

Inmunógeno

NELL2 (NP_006150.1, 301 a.a. ~ 400 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
IQCETLICPNPDCPLKSALAYVDGKCCKECKSICQFQGRTYFEGERNTVYSSSGVCVLYECKDQTMKLVESSGCPALDCPESHQITLSHSCCKVCKGYDF

Forma física

Solution in phosphate buffered saline, pH 7.4

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable