SAB1402172

Monoclonal Anti-DFFA, (C-terminal) antibody produced in mouse

clone 3A11, purified immunoglobulin, buffered aqueous solution

• Sinónimos: DFF-45, DFF1, ICAD
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: mouse
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: 3A11, monoclonal
• formulario: buffered aqueous solution
• mol peso: antigen ~37.22 kDa
• reactividad de especies: human
• técnicas: indirect ELISA: suitable; proximity ligation assay: suitable; western blot: 1-5 μg/mL
• isotipo: IgG2aκ
• Nº de acceso NCBI: NM_004401
• Nº de acceso UniProt: O00273
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... DFFA(1676)

Descripción

Descripción general

Apoptosis is a cell death process that removes toxic and/or useless cells during mammalian development. The apoptotic process is accompanied by shrinkage and fragmentation of the cells and nuclei and degradation of the chromosomal DNA into nucleosomal units. DNA fragmentation factor (DFF) is a heterodimeric protein of 40-kD (DFFB) and 45-kD (DFFA) subunits. DFFA is the substrate for caspase-3 and triggers DNA fragmentation during apoptosis. DFF becomes activated when DFFA is cleaved by caspase-3. The cleaved fragments of DFFA dissociate from DFFB, the active component of DFF. DFFB has been found to trigger both DNA fragmentation and chromatin condensation during apoptosis. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. (provided by RefSeq)

Inmunógeno

DFFA (NP_004392.1, 231 a.a. ~ 331 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
TSSDVALASHILTALREKQAPELSLSSQDLELVTKEDPKALAVALNWDIKKTETVQEACERELALRLQQTQSLHSLRSISASKASPPGDLQNPKRARQDPT

Acciones bioquímicas o fisiológicas

DNA fragmentation factor subunit α (DFFA) is a component of DNA fragmentation factor (DFF). It is mainly associated with apoptosis and genomic stability. Caspase-3-mediated cleavage of DFFA releases DFF40 (DNA fragmentation factor 40) which degrades chromosomal DNA. During menstruation, the apoptosis of endometrium cells is associated with DFFA. Its expression decreases after menopause. Silencing of DFFA increases doxorubicin effects in breast cancer cells.

Forma física

Solution in phosphate buffered saline, pH 7.4

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable