Saltar al contenido
Merck
Todas las fotos(4)

Key Documents

SAB1401891

Sigma-Aldrich

Monoclonal Anti-HOOK3 antibody produced in mouse

clone 3A5, purified immunoglobulin, buffered aqueous solution

Sinónimos:

FLJ31058, HK3

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
Todas las fotos(4)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

mouse

conjugado

unconjugated

forma del anticuerpo

purified immunoglobulin

tipo de anticuerpo

primary antibodies

clon

3A5, monoclonal

formulario

buffered aqueous solution

reactividad de especies

human

técnicas

capture ELISA: suitable
western blot: 1-5 μg/mL

isotipo

IgG2aκ

Nº de acceso NCBI

NM_032410

Nº de acceso UniProt

Q86VS8

Condiciones de envío

dry ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... HOOK3(84376)

Descripción general

Hook proteins are cytosolic coiled-coil proteins that contain conserved N-terminal domains, which attach to microtubules, and more divergent C-terminal domains, which mediate binding to organelles. The Drosophila Hook protein is a component of the endocytic compartment.[supplied by OMIM

Inmunógeno

HOOK3 (NP_115786.1, 622 a.a. ~ 718 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QNQGAAPEIQALKNQLQERDRLFHSLEKEYEKTKSQREMEEKYIVSAWYNMGMTLHKKAAEDRLASTGSGQSFLARQRQATSSRRSYPGHVQPATAR

Acciones bioquímicas o fisiológicas

In Caenorhabditis elegans, the HOOK3 (hook microtubule-tethering protein 3) protein is required for connecting the centrosome and the nucleus. It participates in transport of pericentriolar satellites, needed for centrosomal assembly in neurogenesis. HOOK3-RET (ret proto-oncogene) fusion protein is identified in papillary thyroid carcinoma and it results in tumor formation in nude mice. In presence of Salmonella enterica infection, the Salmonella SpiC (pathogenicity island 2 secreted effector protein) inactivates HOOK3 function and thereby affects the cellular trafficking and phagosome-lysosome fusion.

Forma física

Solution in phosphate buffered saline, pH 7.4

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Nathaniel Melling et al.
PloS one, 10(7), e0134614-e0134614 (2015-08-01)
Hook microtubule-tethering protein 3 (HOOK3) is an adaptor protein for microtubule-dependent intracellular vesicle and protein trafficking. In order to assess the role of HOOK3 in prostate cancer we analyzed HOOK3 expression by immunohistochemistry on a TMA containing more than 12,400
Yoram Shotland et al.
Molecular microbiology, 49(6), 1565-1576 (2003-09-03)
The Salmonella SpiC protein is secreted into the cytosol of macrophages via a unique type III secretion system that functions intracellularly to translocate proteins across the phagosomal membrane. The SpiC protein is required for survival within macrophages and inhibition of
Raffaele Ciampi et al.
Endocrine-related cancer, 14(2), 445-452 (2007-07-20)
Chromosomal rearrangements of the RET proto-oncogene (RET/PTC) are the common feature of papillary thyroid carcinoma (PTC). In this study, we report the identification, cloning, and functional characterization of a novel type of RET/PTC rearrangement that results from the fusion of
Xuecai Ge et al.
Neuron, 65(2), 191-203 (2010-02-16)
Centrosome functions are important in multiple brain developmental processes. Proper functioning of the centrosome relies on assembly of protein components into the pericentriolar material. This dynamic assembly is mediated by the trafficking of pericentriolar satellites, which are comprised of centrosomal

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico