Saltar al contenido
Merck
Todas las fotos(3)

Documentos clave

SAB1401866

Sigma-Aldrich

Monoclonal Anti-ISCA1 antibody produced in mouse

clone 1A11, purified immunoglobulin, buffered aqueous solution

Sinónimos:

HBLD2, ISA1, MGC4276, RP11-507D14.2, hIscA

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

mouse

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

purified immunoglobulin

tipo de anticuerpo

primary antibodies

clon

1A11, monoclonal

Formulario

buffered aqueous solution

reactividad de especies

human

técnicas

capture ELISA: suitable
western blot: 1-5 μg/mL

isotipo

IgG2aλ

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

dry ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... ISCA1(81689)

Descripción general

ISCA1 is a mitochondrial protein involved in the biogenesis and assembly of iron-sulfur clusters, which play a role in electron-transfer reactions (Cozar-Castellano et al., 2004 [PubMed 15262227]).[supplied by OMIM

Inmunógeno

ISCA1 (AAH02675, 1 a.a. ~ 129 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MSASLVRATVRAVSKRKLQPTRAALTLTPSAVNKIKQLLKDKPEHVGVKVGVRTRGCNGLSYTLEYTKTKGDSDEEVIQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNI

Acciones bioquímicas o fisiológicas

ISCA1 (iron-sulfur cluster assembly 1) is an A-type protein that maintains the assembly of a subset of Fe/S apoproteins. Depletion of the protein leads to structural alterations in mitochondria involving organelle enlargement and a loss of cristae membranes. ISCA1 is considered as an iron binding protein. It might serve as an iron chaperone and be involved in the formation of iron clusters.

Características y beneficios

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Forma física

Solution in phosphate buffered saline, pH 7.4

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

12 - Non Combustible Liquids

Clase de riesgo para el agua (WGK)

WGK 1

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Tracey A Rouault et al.
Trends in genetics : TIG, 24(8), 398-407 (2008-07-09)
Iron-sulfur (Fe-S) clusters are essential for numerous biological processes, including mitochondrial respiratory chain activity and various other enzymatic and regulatory functions. Human Fe-S cluster assembly proteins are frequently encoded by single genes, and inherited defects in some of these genes
Human ISCA1 interacts with IOP1/NARFL and functions in both cytosolic and mitochondrial iron-sulfur protein biogenesis.
Song D
The Journal of Biological Chemistry, 284(51), 35297-35307 (2009)
Alex D Sheftel et al.
Molecular biology of the cell, 23(7), 1157-1166 (2012-02-11)
Members of the bacterial and mitochondrial iron-sulfur cluster (ISC) assembly machinery include the so-called A-type ISC proteins, which support the assembly of a subset of Fe/S apoproteins. The human genome encodes two A-type proteins, termed ISCA1 and ISCA2, which are
Daisheng Song et al.
The Journal of biological chemistry, 284(51), 35297-35307 (2009-10-30)
Iron-sulfur proteins play an essential role in many biologic processes. Hence, understanding their assembly is an important goal. In Escherichia coli, the protein IscA is a product of the isc (iron-sulfur cluster) operon and functions in the iron-sulfur cluster assembly
Iron-sulfur cluster biogenesis and human disease.
Rouault TA and Tong WH
Trends in Genetics, 24(8), 398-407 (2008)

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico