SAB1401359

Monoclonal Anti-SEC13 antibody produced in mouse

clone 1G7, purified immunoglobulin, buffered aqueous solution

• Sinónimos: D3S1231E, SEC13L1, SEC13R, npp-20
• Código UNSPSC: 12352203
• NACRES: NA.41
• conjugado: unconjugated
• application: ELISA (c); IF; IP
• clon: 1G7, monoclonal
• reactividad de especies: human
• técnicas: capture ELISA: suitable; immunofluorescence: suitable; immunoprecipitation (IP): suitable

Propiedades

• origen biológico: mouse
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: 1G7, monoclonal
• Formulario: buffered aqueous solution
• reactividad de especies: human
• técnicas: capture ELISA: suitable; immunofluorescence: suitable; immunoprecipitation (IP): suitable
• isotipo: IgG2aκ
• Nº de acceso NCBI: NM_030673
• Nº de acceso UniProt: P55735
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... SEC13(6396)

Descripción

Descripción general

The protein encoded by this gene belongs to the SEC13 family of WD-repeat proteins. It is a constituent of the endoplasmic reticulum and the nuclear pore complex. It has similarity to the yeast SEC13 protein, which is required for vesicle biogenesis from endoplasmic reticulum during the transport of proteins. Multiple alternatively spliced transcript variants have been found. (provided by RefSeq)

Inmunógeno

SEC13 (NP_109598, 226 a.a. ~ 324 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SIGLPTSTIASCSQDGRVFIWTCDDASSNTWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQWVCISDVNKGQGSVSASVTEGQQNE

Forma física

Solution in phosphate buffered saline, pH 7.4

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable