Saltar al contenido
Merck
Todas las fotos(4)

Documentos clave

SAB1401244

Sigma-Aldrich

Monoclonal Anti-MGAT5 antibody produced in mouse

clone 3E9, purified immunoglobulin, buffered aqueous solution

Sinónimos:

GNT-V, GNT-VA

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

mouse

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

purified immunoglobulin

tipo de anticuerpo

primary antibodies

clon

3E9, monoclonal

Formulario

buffered aqueous solution

reactividad de especies

human

técnicas

capture ELISA: suitable
western blot: 1-5 μg/mL

isotipo

IgG2aκ

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

dry ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... MGAT5(4249)

Categorías relacionadas

Descripción general

This gene encodes mannosyl (alpha-1,6-)-glycoprotein beta-1,6-N-acetyl-glucosaminyltransferase, a glycosyltransferase involved in the synthesis of protein-bound and lipid-bound oligosaccharides. Alterations of the oligosaccharides on cell surface glycoproteins cause significant changes in the adhesive or migratory behavior of a cell. Increase in the encoded protein′s activity may correlate with the progression of invasive malignancies. (provided by RefSeq)

Inmunógeno

MGAT5 (NP_002401, 642 a.a. ~ 739 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LAEPGQSCKQVCQESQLICEPSFFQHLNKDKDMLKYKVTCQSSELAKDILVPSFDPKNKHCVFQGDLLLFSCAGAHPRHQRVCPCRDFIKGQVALCKD

Acciones bioquímicas o fisiológicas

MGAT5 (mannosyl (α-1,6-)-glycoprotein β-1,6-N-acetylglucosaminyltransferase) is involved in the biosynthesis of N-linked glycoproteins. It catalyzes the formation of β
1,6-branched N-glycans by N-acetyl-d-glucosamine transfer. MGAT5 plays a significant role in invasion and metastasis of various cancer, including glioma and hepatocellular carcinoma. It is also known to be associated with multiple sclerosis and liver fibrosis. Increased radiosensitivity of cancer cells is observed upon MGAT5 inhibition.

Forma física

Solution in phosphate buffered saline, pH 7.4

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Arisa Kato et al.
Experimental dermatology, 24(8), 585-590 (2015-04-17)
Oligosaccharide modification by N-acetylglucosaminyltransferase-V (GnT-V), which catalyses the formation of β1,6 GlcNAc (N-acetylglucosamine) branches on N-glycans, is associated with various pathologies, such as cancer metastasis, multiple sclerosis and liver fibrosis. In this study, we demonstrated the involvement of GnT-V in
Oligosaccharide modification by N-acetylglucosaminyltransferase-V in macrophages are involved in pathogenesis of bleomycin-induced scleroderma.
Kato A
Experimental Dermatology, 24(8), 585-590 (2015)
A Loukola et al.
Molecular psychiatry, 19(5), 615-624 (2013-06-12)
Smoking is a major risk factor for several somatic diseases and is also emerging as a causal factor for neuropsychiatric disorders. Genome-wide association (GWA) and candidate gene studies for smoking behavior and nicotine dependence (ND) have disclosed too few predisposing
Effect of GnT-V knockdown on the proliferation, migration and invasion of the SMMC7721/R human hepatocellular carcinoma drug-resistant cell line.
Li B
Molecular Medicine Reports, 13(1), 469-476 (2016)
Radiosensitisation of human glioma cells by inhibition of ?1,6-GlcNAc branched N-glycans.
Shen L
Tumour Biology : the Journal of the International Society For Oncodevelopmental Biology and Medicine, 37(4), 4909-4918 (2016)

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico