Saltar al contenido
Merck
Todas las fotos(10)

Documentos clave

SAB1400160

Sigma-Aldrich

Monoclonal Anti-SMAD3 antibody produced in mouse

clone 7F3, purified immunoglobulin, buffered aqueous solution

Sinónimos:

Anti-DKFZP586N0721, Anti-DKFZp686J10186, Anti-HSPC193, Anti-HsT17436, Anti-JV152, Anti-MADH3, Anti-MGC60396, Anti-Smad 3

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Número MDL:
Código UNSPSC:
12352203
NACRES:
NA.43

origen biológico

mouse

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

purified immunoglobulin

tipo de anticuerpo

primary antibodies

clon

7F3, monoclonal

Formulario

buffered aqueous solution

reactividad de especies

human, rat

técnicas

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
proximity ligation assay: suitable
western blot: 1-5 μg/mL

isotipo

IgG1κ

Nº de acceso UniProt

aplicaciones

research pathology

Condiciones de envío

dry ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... SMAD3(4088)

Descripción general

Mothers against decapentaplegic homolog 3 (SMAD3) protein is an important constituent of the transforming growth factor-beta (TGF-β) signaling pathway. Mad homology 1 (MH1) and Mad homology 2 (MH2) are the two functional domains of the SMAD3. The SMAD3 gene is located on human chromosome 15q22.33.

Inmunógeno

SMAD3 (NP_005893, 120 a.a. ~ 221 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
VCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDL

Aplicación

Monoclonal Anti-SMAD3 antibody produced in mouse has been used in immunohistochemistry (1:200).

Acciones bioquímicas o fisiológicas

Mothers against decapentaplegic homolog 3 (SMAD3) protein possesses tumor-suppressive actions. It is involved in epithelial to mesenchymal transition (EMT). SMAD3 also possesses tumor-promoting actions of transforming growth factor-beta (TGF-β). The N-terminal domain Mad homology 1 (MH1) of SMAD3 plays a role in DNA binding. The SMAD3 gene mutation is linked to an increased incidence of knee osteoarthritis. DNA methylation change in the SMAD3 gene promoter is associated with atopic asthma. SMAD3 protein plays a regulatory role in immune responses. It also modulates fibrosis in the airways.

Forma física

Solution in phosphate buffered saline, pH 7.4

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Opcional

Referencia del producto
Descripción
Precios

Código de clase de almacenamiento

10 - Combustible liquids

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Bertrand Chesneau et al.
Molecular genetics & genomic medicine, 8(5), e1132-e1132 (2020-03-11)
Pathogenic SMAD3 variants are responsible for a cardiovascular phenotype, mainly thoracic aortic aneurysms and dissections. Precocious identification of the vascular risk such as aortic dilatation in mutated patients has a major impact in terms of management, particularly to avoid dissection
Astrid Jeibmann et al.
Journal of neuro-oncology, 131(3), 477-484 (2017-01-22)
Atypical teratoid/rhabdoid tumors (ATRT) are highly malignant brain tumors arising in young children. The majority of ATRT is characterized by inactivation of the chromatin remodeling complex member SMARCB1 (INI1/hSNF5). Little is known, however, on downstream pathways involved in the detrimental
Tianli Cheng et al.
International journal of oncology, 45(5), 1977-1988 (2014-09-02)
Altered expression of miRNAs contributes to development and progression of non-small cell lung cancer (NSCLC), while transforming growth factor-β (TGF-β) promotes NSCLC cell epithelial-mesenchymal transition. This study aimed to investigate the effects of TGF-β-induced miR‑143 expression in regulation of NSCLC
Nicolás Tobar et al.
BMC cancer, 14, 640-640 (2014-09-02)
Hard consistency, developed under the influence of tumor cell factors, is a characteristic feature of a breast tumor. Activation of resident fibroblasts leading to a myofibroblast phenotype is the principal feature that orchestrates this fibrotic process. The aim of this
Jinyi Han et al.
Experimental biology and medicine (Maywood, N.J.), 239(3), 272-283 (2014-02-07)
All-trans retinoic acid (ATRA) has been used for the treatment of acute promyelocytic leukemia. It remains unclear, however, whether ATRA affects cyclooxygenase-2 (COX-2; an enzyme involved in prostaglandin production), PGE2, and thromboxane A2 (TXA2) (metabolic products of COX-2) by a

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico