MSST0014
SILu™Lite AMBP Alpha-1 Microglycoprotein human
recombinant, expressed in HEK 293 cells, MS protein standard
Sinónimos:
Alpha-1-microglobulin, Complex-forming glycoprotein heterogeneous in charge
Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
About This Item
Código UNSPSC:
23201100
NACRES:
NA.12
Productos recomendados
origen biológico
human
Nivel de calidad
recombinante
expressed in HEK 293 cells
etiqueta
His tagged
Análisis
≥98% (SDS-PAGE)
formulario
lyophilized powder
técnicas
mass spectrometry (MS): suitable
idoneidad
suitable for mass spectrometry (internal calibrator)
Nº de acceso UniProt
temp. de almacenamiento
−20°C
Información sobre el gen
human ... AMBP(259)
Categorías relacionadas
Descripción general
SILu™ Lite AMBP is a recombinant human protein expressed in human 293 cells. It is a monomer of 204 amino acids (including C-terminal polyhistidine and flag tags), with a molecular weight of ~23 kDa. SILu™ Lite AMBP is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.
Acciones bioquímicas o fisiológicas
AMBP is synthesized by the liver. Approximately half of the circulating protein is complexed to IgA. The free form of AMBP is filtered by the glomerulus and reabsorbed by proximal tubule cells. AMBP has been found to be a sensitive biomarker for proximal tubular dysfunction even in the early phase of injury when no histologic damage is observable. In addition, urinary AMBP has been proposed to be a useful marker of tubular dysfunction even in low-gestational-age preterm infants, a population at high risk for AKI (Acute Kidney Injury). Urinary AMBP is also a marker of kidney damage in type 2 diabetes.
Secuencia
GPVPTPPDNIQVQENFNISRIYGKWYNLAIGSTCPWLKKIMDRMTVSTLVLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITMESYVVHTNYDEYAIFLTKKFSRHHGPTITAKLYGRAPQLRETLLQDFRVVAQGVGIPEDSIFTMADRGECVPGEQEPEPILIPRVDYKDDDDKGHHHHHHHHGGQ
Forma física
Supplied as a lyophilized powder containing phosphate buffered saline.
Información legal
This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.
SILu is a trademark of Sigma-Aldrich Co. LLC
Código de clase de almacenamiento
11 - Combustible Solids
Clase de riesgo para el agua (WGK)
WGK 2
Punto de inflamabilidad (°F)
Not applicable
Punto de inflamabilidad (°C)
Not applicable
Certificados de análisis (COA)
Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»
¿Ya tiene este producto?
Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.
Elisa Bellei et al.
The journal of headache and pain, 16, 559-559 (2015-08-15)
Medication-overuse headache (MOH) is a chronic disorder that results from the overuse of analgesics drugs, triptans or other acute headache compounds. Although the exact mechanisms underlying MOH remain still unknown, several studies suggest that it may be associated with development
Vishal S Vaidya et al.
Annual review of pharmacology and toxicology, 48, 463-493 (2007-10-17)
Acute kidney injury (AKI) is a common condition with a high risk of death. The standard metrics used to define and monitor the progression of AKI, such as serum creatinine and blood urea nitrogen levels, are insensitive, nonspecific, and change
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.
Póngase en contacto con el Servicio técnico