HPA039557
Anti-TAZ antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Sinónimos:
Anti-BTHS, Anti-CMD3A, Anti-EFE, Anti-EFE2, Anti-G4.5, Anti-Tafazzin, Anti-XAP-2
Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
About This Item
Productos recomendados
origen biológico
rabbit
Nivel de calidad
conjugado
unconjugated
forma del anticuerpo
affinity isolated antibody
tipo de anticuerpo
primary antibodies
clon
polyclonal
Línea del producto
Prestige Antibodies® Powered by Atlas Antibodies
formulario
buffered aqueous glycerol solution
reactividad de especies
human
validación mejorada
orthogonal RNAseq
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
técnicas
immunohistochemistry: 1:20- 1:50
secuencia del inmunógeno
WHVGMNDVLPNSPPYFPRFGQKITVLIGKPFSALPVLERLRAENKSAVEMRKALTDFIQEEFQHLKTQAEQLHNHLQP
Nº de acceso UniProt
Condiciones de envío
wet ice
temp. de almacenamiento
−20°C
modificación del objetivo postraduccional
unmodified
Información sobre el gen
human ... TAZ(6901)
Categorías relacionadas
Descripción general
Tafazzin (TAZ) is encoded by the WW domain containing transcription regulator 1 (WWTR1) gene mapped to human chromosome Xq28. The encoded protein contains 400 amino acids. It is characterized by a conserved WW domain, implicated in binding PPXY motif, a coiled-coil region associated with protein-protein interaction and a C-terminal motif involved in binding the PDZ domain.
Inmunógeno
tafazzin recombinant protein epitope signature tag (PrEST)
Aplicación
Anti-TAZ antibody produced in rabbit has been used in immunohistochemistry and immunoprecipitation.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)
Immunohistochemistry (1 paper)
Acciones bioquímicas o fisiológicas
Tafazzin (TAZ) plays a vital role in the various cellular process including cell proliferation, differentiation, apoptosis, migration, invasion, epithelial-mesenchymal transition (EMT) and stemness in multiple human cancers. TAZ associates with other transcription factors such as RUNX2 (runt-related transcription factor 2), PPAR (peroxisome proliferator-activated receptor), PAX3 and 8 (paired box gene 3 and 8) and TTF1 (thyroid transcription factor 1) and plays an essential role in osteoblastic, myogenic and adipogenic differentiation.
Características y beneficios
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Ligadura / enlace
Corresponding Antigen APREST77964
Forma física
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.
Información legal
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Cláusula de descargo de responsabilidad
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
¿No encuentra el producto adecuado?
Pruebe nuestro Herramienta de selección de productos.
Código de clase de almacenamiento
10 - Combustible liquids
Clase de riesgo para el agua (WGK)
WGK 1
Punto de inflamabilidad (°F)
Not applicable
Punto de inflamabilidad (°C)
Not applicable
Certificados de análisis (COA)
Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»
¿Ya tiene este producto?
Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.
Surajit Pathak et al.
PloS one, 9(5), e98317-e98317 (2014-05-27)
Tafazzin (TAZ), a transmembrane protein contributes in mitochondrial structural and functional modifications through cardiolipin remodeling. TAZ mutations are associated with several diseases, but studies on the role of TAZ protein in carcinogenesis and radiotherapy (RT) response is lacking. Therefore we
Tafazzin protein expression is associated with tumorigenesis and radiation response in rectal cancer: a study of Swedish clinical trial on preoperative radiotherapy.
Pathak S
PLoS ONE, 9 (2014)
Yugang Wen et al.
Journal of personalized medicine, 10(4) (2020-10-18)
Radiation therapy has long been contemplated as an important mode in the treatment of rectal cancer. However, there are few ideal tools available for clinicians to make a radiotherapy decision at the time of diagnosis for rectal cancer. The purpose
Regulation of TAZ in cancer.
Zhou X and Lei QY
Protein & cell, 7, 548-561 (2016)
A role for TAZ in migration, invasion, and tumorigenesis of breast cancer cells.
Chan SW
Cancer Research, 68, 2592-2598 (2008)
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.
Póngase en contacto con el Servicio técnico