HPA031531

Anti-CAPZB antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinónimos: Anti-CD85k, Anti-HM18, Anti-ILT3, Anti-LIR-5, Anti-capping protein (actin filament) muscle Z-line, β
• Código UNSPSC: 12352203
• Atlas de proteínas humanas número: HPA031531
• NACRES: NA.43

Propiedades

• origen biológico: rabbit
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Línea del producto: Prestige Antibodies^® Powered by Atlas Antibodies
• formulario: buffered aqueous glycerol solution
• reactividad de especies: mouse, human, rat
• técnicas: immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:50-1:200
• secuencia del inmunógeno: CALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPP
• Nº de acceso UniProt: P47756
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... CAPZB(832)

Descripción

Descripción general

CAPZB (capping actin protein of muscle Z-line β subunit) gene is mapped to human chromosome 1p36.13. It is widely expressed in pharyngeal arch, and also in lymphoid cells, seminiferous ducts, urothelium and placenta. The gene codes for β-subunit of the barbed-end F-actin-binding protein.

Inmunógeno

capping protein (actin filament) muscle Z-line, beta recombinant protein epitope signature tag (PrEST)

Aplicación

All Prestige Antibodies^®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Anti-CAPZB antibody produced in rabbit has been used in immunoblotting and immunofluorescence procedures.

Acciones bioquímicas o fisiológicas

CAPZB (capping actin protein of muscle Z-line βsubunit) is a heterodimeric protein that caps the growing end of F-actin. This actin-capping protein facilitates the joining of actin filaments to the Z-line of the sarcomere in muscles, thereby modulating the cytoskeleton. The protein regulates actin filament dynamics by blocking actin filament assembly and disassembly, and thereby, modulating cell shape and movement in vitro. It is known to promote cell motility by increasing the depolymerization and capping of actin filaments. CAPZB is associated with tumor progression in cases of epithelioid sarcoma.

Características y beneficios

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST76535

Forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable