HPA025062

Anti-SLCO5A1 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinónimos: Anti-OATP-RP4, Anti-OATPRP4, Anti-Organic anion transporter polypeptide-related protein 4, Anti-Solute carrier family 21 member 15, Anti-Solute carrier organic anion transporter family member 5A1
• Código UNSPSC: 12352203
• Atlas de proteínas humanas número: HPA025062
• NACRES: NA.43

Propiedades

• origen biológico: rabbit
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Línea del producto: Prestige Antibodies^® Powered by Atlas Antibodies
• formulario: buffered aqueous glycerol solution
• reactividad de especies: human
• técnicas: immunohistochemistry: 1:20- 1:50
• secuencia del inmunógeno: SVDAVSDDDVLKEKSNNSEQADKKVSSMGFGKDVRDLPRAAVRILSNM
• Nº de acceso UniProt: Q9H2Y9
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... SLCO5A1(81796)

Descripción

Descripción general

The gene SLCO5A1 (solute carrier organic anion transporter family member 5A1) is mapped to human chromosome 8q13.3. The mRNA is expressed in the brain, heart, skeletal muscle and ovary. In addition, it is also expressed in bone tumors, prostate cancer, breast cancer, drug-resistant small cell lung cancer and liver cancer. The SLCO5A1 protein belongs to the OATP5 (organic anion-transporting polypeptide 5) family of proteins. The protein has 12 transmembrane domains and shows different localization depending on the tissue.

Inmunógeno

Solute carrier organic anion transporter family member 5A1 recombinant protein epitope signature tag (PrEST)

Aplicación

All Prestige Antibodies^®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.
Anti-SLCO5A1 antibody produced in rabbit has been used in Western blotting, immunofluorescence and flow cytometry.

Acciones bioquímicas o fisiológicas

SLCO5A1 (solute carrier organic anion transporter family member 5A1) might be involved in cellular responses associated with the reorganization of the cell morphology, for instance differentiation and migration.

Características y beneficios

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST76253

Forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable