HPA023861

Anti-AFMID antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab1

• Sinónimos: Anti-KF, Anti-Kynurenine formamidase, Anti-Probable arylformamidase
• Código UNSPSC: 12352203
• Atlas de proteínas humanas número: HPA023861
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Línea del producto: Prestige Antibodies^® Powered by Atlas Antibodies
• Formulario: buffered aqueous glycerol solution
• reactividad de especies: human
• validación mejorada: recombinant expression; Learn more about Antibody Enhanced Validation
• técnicas: immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:50-1:200
• secuencia del inmunógeno: VSGVGFPSKVPWKKMSAEELENQYCPSRWVVRLGAEEALRTYSQIGIEATTRARATRKSLLHVPYGD
• Nº de acceso UniProt: Q63HM1
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... AFMID(125061)

Descripción

Descripción general

AFMID, kynurenine formamidase also called arylformamidase, is located on human chromosome 17q25.3. AFMID catalyses the hydrolysis of NFK (N-formyl-L-kynurenine) to kynurenine.

Inmunógeno

Probable arylformamidase recombinant protein epitope signature tag (PrEST)

Aplicación

Anti-AFMID antibody produced in rabbit may be used for the detection of AFMID protein in western blotting.

Acciones bioquímicas o fisiológicas

The conversion of tryptophan to nicotinic acid is catalysed by kynurenine formamidase. Alternative splicing in kynurenine formamidase gene modulates tumor suppressor p53 role in hepatocellular carcinoma development and progression. Indoleamine 2,3-dioxygenase-mediated kynurenine formation could play a role in cataract formation related to chronic inflammation.

Características y beneficios

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST75936

Forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable