Saltar al contenido
Merck
Todas las fotos(10)

Key Documents

HPA023822

Sigma-Aldrich

Anti-ARFGEF1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab2

Sinónimos:

Anti-Brefeldin A-inhibited GEP 1, Anti-Brefeldin A-inhibited guanine nucleotide-exchange protein 1, Anti-p200 ARF guanine nucleotide exchange factor, Anti-p200 ARF-GEP1

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
Atlas de proteínas humanas número:
NACRES:
NA.43

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Línea del producto

Prestige Antibodies® Powered by Atlas Antibodies

formulario

buffered aqueous glycerol solution

reactividad de especies

human, mouse

técnicas

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:20-1:50

secuencia del inmunógeno

QALQEAKQMEKERHRQHHHLLQSPVSHHEPESPQLRYLPPQTVDHISQEHEGDLDLHTNDVDKSLQDDTEPENGSDISSAENEQTEA

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... ARFGEF1(10565)

Descripción general

The gene ARFGEF1 (ADP ribosylation factor guanine nucleotide exchange factor 1), also referred to as BIG1 (brefeldin A-inhibited guanine nucleotide-exchange protein), is a guanine nucleotide exchange factor that acts on trans-Golgi. The gene is mapped to human chromosome 8.

Inmunógeno

Brefeldin A-inhibited guanine nucleotide-exchange protein 1 recombinant protein epitope signature tag (PrEST)

Aplicación

Anti-ARFGEF1 antibody produced in rabbit has been used for immunofluorescence. All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Acciones bioquímicas o fisiológicas

The gene ARFGEF1 (ADP ribosylation factor guanine nucleotide exchange factor 1) encodes an ADP-ribosylation factor that catalyzes the replacement of bound GDP with GTP via the activation of class I ADP-ribosylation factors (ARF1-3). This process is necessary for the regulation of protein transport in eukaryotic cells. It also functions as a scaffolding protein and interacts with various proteins in other compartments of the cell. Knock-down of BIG1 and BIG2, a closely related guanine-nucleotide exchange factor, results in disruption of localization of certain proteins associated with the trans-Golgi network (TGN) and recycling endosomes. The retrograde transport of furin from late endosomes to the TGN is also inhibited in the absences of these two proteins.

Características y beneficios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST76184

Forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 1

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Dylan Mordaunt et al.
Pediatric neurology, 52(2), 230-234 (2015-02-20)
Cerebellar vermis hypoplasia has been associated with a large number of chromosomal abnormalities and metabolic disorders, with few candidate genes clearly linked to isolated cerebellar vermis hypoplasia. We describe on a 12-year-old boy with inferior vermian hypoplasia associated with a
Ray Ishizaki et al.
Molecular biology of the cell, 19(6), 2650-2660 (2008-04-18)
BIG2 and BIG1 are closely related guanine-nucleotide exchange factors (GEFs) for ADP-ribosylation factors (ARFs) and are involved in the regulation of membrane traffic through activating ARFs and recruiting coat protein complexes, such as the COPI complex and the AP-1 clathrin
Ju Hee Kim et al.
BMB reports, 44(8), 523-528 (2011-08-30)
To identify novel genes that are regulated by promoter methylation, a combinational approach involving in silico mining followed by molecular assay was performed. From the expression microarray data registered in the European bioinformatics institute (EBI), genes showing downregulation in breast

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico