HPA023544

Anti-DUOX1 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinónimos: Anti-Dual oxidase 1, Anti-Large NOX 1, Anti-Long NOX 1, Anti-NADPH thyroid oxidase 1, Anti-Thyroid oxidase 1
• Código UNSPSC: 12352203
• Atlas de proteínas humanas número: HPA023544

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Línea del producto: Prestige Antibodies^® Powered by Atlas Antibodies
• formulario: buffered aqueous glycerol solution
• reactividad de especies: human
• validación mejorada: orthogonal RNAseq; orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• técnicas: immunohistochemistry: 1:50-1:200
• secuencia del inmunógeno: QHKEELTWEDFHFMLRDHNSELRFTQLCVKGVEVPEVIKDLCRRASYISQDMICPSPRVSARCSRSDIETELTPQRLQCPMDTDPPQEIRRRFGKKVTSFQP
• Nº de acceso UniProt: Q9NRD9
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... DUOX1(53905)

Descripción

Descripción general

The gene DUOX1 (dual oxidase 1) encodes a protein belonging to the family of NADPH oxidase/heme peroxidase proteins, Duox, and shares upto 85% amino acid similarity with another Duox isoform, Duox2. It contains an NAD(P)H oxidase domain and a heme peroxidase domain. The NAD(P)H oxidase domain of this protein is involved in H₂O₂ production and the heme peroxidase domain is similar to several peroxidases, but its function is yet to be characterized. The expression of Duox1 is stimulated by Th2 (T helper) cytokines, IL-4 (interleukin-4) and IL-13 (interleukin-13). The gene is mapped to human chromosome 15q15.3.

Inmunógeno

Dual oxidase 1 Precursor recombinant protein epitope signature tag (PrEST)

Aplicación

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Acciones bioquímicas o fisiológicas

The gene DUOX1 (dual oxidase 1) encodes a dual function NAD(P)H oxidase/peroxidase that serves as an important source for the production of hydrogen peroxide in respiratory tract epithelium. H₂O₂, thus produced, is involved in the regulation of cellular signaling pathways that participate in the production of inflammatory effectors. ATP-mediated activation of duox1 causes activation of ERK1/2 (extracellular signal-regulated kinase ½) and NFκ-B (nuclear factor κ-light-chain-enhancer of activated B cells) pathways. Duox1 is also involved in the regulation of pathways associated with production of various mucins, matrix metalloproteinase-9, and other inflammatory mediators, in response to environmental or bacterial stimuli.

Características y beneficios

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST73296

Forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable